PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000655623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 237aa    MW: 26733.1 Da    PI: 4.5893
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000655623genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM92.85.6e-29421741128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkev 92 
                    lp G+rF+Pt++e+vv++L +k+ ++ +++ + ikevd+y ++P +Lp+   k++a+ +  y+F++r+   a++ +  + a++  yWk    + ev
  MDP0000655623  42 LPLGYRFNPTEDEIVVYFLFNKIMDRAMPTYDLIKEVDVYXYDPXQLPNgdfKHNAGCNAAYYFANREPFDASEGKIIKtAANGXYWKVIDDEYEV 137
                    699*********************************************5455666677788*******999987776664778889*********9 PP

            NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    l k ++  vg   ++ fy+g++p+g+kt  vm+eyrl
  MDP0000655623 138 LFKdSEVIVGFEAVMNFYEGKEPNGTKTPFVMNEYRL 174
                    998455669**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-3239202IPR003441NAC domain
PROSITE profilePS5100534.12642203IPR003441NAC domain
PfamPF023652.6E-1343174IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MASSASSQSS SASSQSADKY EGFDLLKCST VQEGKKEAEV KLPLGYRFNP TEDEIVVYFL  60
FNKIMDRAMP TYDLIKEVDV YXYDPXQLPN GDFKHNAGCN AAYYFANREP FDASEGKIIK  120
TAANGXYWKV IDDEYEVLFK DSEVIVGFEA VMNFYEGKEP NGTKTPFVMN EYRLNPXVVP  180
AHVLNDSIRN KIERYVVCRI INEEVSNQPV IDYKKESLEL LLKYASAGTV KDGEPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-21322045169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981260.0KF198126.1 Malus hupehensis NAC domain protein (NAC119) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008389427.11e-171PREDICTED: NAC transcription factor 29
RefseqXP_008389426.11e-171PREDICTED: NAC transcription factor 29
RefseqXP_008389425.11e-171PREDICTED: NAC transcription factor 29
TrEMBLS5RSJ31e-157S5RSJ3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15772611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-26NAC-like, activated by AP3/PI